3456789 251 - 300 of 1441
rss atomLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
  • Williams, Henrik
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Språkvetenskapliga fakulteten, Institutionen för nordiska språk.
    Sven Wernströms pojkbok Stein, den obesegrade: Litterär onomastik och runsvenska mansnamn2018Inngår i: Katharina och namnen: Vänskrift till Katharina Leibringpå 60-årsdagen den 20 januari 2018 / [ed] Leila Mattfolk & Kristina Neumüller (huvudred.), Josefin Devine, Elin Pihl, Lennart Ryman & Annette C. Torensjö, Uppsala: Uppsala universitet, 2018, s. 55-59Kapittel i bok, del av antologi (Annet vitenskapelig)
  • Kullberg, Christian
    et al.
    Högskolan Dalarna.
    Skillmark, Mikael
    Linnéuniversitetet, Institutionen för socialt arbete (SA).
    Nord, Carina
    Socialt arbete.
    Pers, Anna
    Socialt arbete.
    Fäldt, Johannes
    Mälardalens högskola.
    Förståelse, bedömningar och hjälpinsatser: Socialarbetares arbete med män som våldsoffer2015Rapport (Annet vitenskapelig)
    Abstract [en]

    This report outlines the background to, and presents the results from the Crime Victim Compensation and Support Authority funded project "Social Workers' understanding of men as victims of crime". The project aimed at describing and analyzing how social workers understand and work with male victims of violence. More precisely, the research has focused on how social workers describe men's vulnerability and how they understand men's needs for assistance, what assistance that is provided and the way the constellations of perpetrators and victims of different gender and contexts in which the violence occurs in affect the understanding of male victims of violence. The study has also been devoted to the question of whether the Support Centers for young crime victims in Sweden provide different types of and different amount of help to young men and women afflicted of violence. The project was conducted in three substudies.

    The results from substudy 1 show that more young men than women seek support from the Support centers studied. Men predominate in number of cases and in the different categories of crime. The results also show that young men on average receive less assistance over a shorter average duration than young women. This applies irrespective of the category of offense that the vulnerability applies to. Furthermore, the young men, compared to the women, proportionally receive fewer interventions characterized as support and a greater proportion of interventions in the form of information. The results also show that the young men are referred on for further action to a lesser extent than is the case for women.

    The results from substudy 2 show that social workers tend to focus on whether, and to what extent, young men who are victims of violence themselves have behaved provocatively before the violence incident and if they have put themselves in a social situation that could be interpreted as having contributed to an escalation of the violence they have been subjected to. The results from substudy 2 also show that social workers talk about the men as active in the violent situations they have been involved in and dwell on the extent to which the young men's own actions have contributed to the violence. The results also show that young men who are victims of violence are described as "reluctant" victims who are trying to cope with their situation on their own without the involvement of professional or other helper. The young men are also described as reluctant to talk about their feelings.

    The results of substudy 3 show that social workers believe that young men, when they become victims of violence, risks losing their sense of autonomy, initiative and decisiveness, that is, attributes that are often linked to the dominating cultural image of masculinity. Furthermore, the results show that social workers estimate that men's practicing of their masculinity, but also the response that men who are traumatized get from society, creates difficulties for them to get help. The results from substudy 3 also shows that attributes and actions that can be connected to the masculinity of young men's, as well as a lack of such attributes and actions are considered to be adequate explanations for the violence the men has suffered. When it comes to violence in public places it is the masculinity that explains the violence and its escalation. When it comes to domestic violence it is the lack of expected male attributes and actions that are used as explanations for the violence that have occurred.

    The discussion is devoted to the question of how the results should be understood based on the concepts of self-performance, interpretation, negotiation and categorizations, and the consequences the results obtained should have for gender sensitive social work given to abused men.

  • Skillmark, Mikael
    et al.
    Linnéuniversitetet, Institutionen för socialt arbete (SA).
    Denvall, Verner
    Linnéuniversitetet, Institutionen för socialt arbete (SA).
    When research moves in: the diffusion of evidence-based practice in Swedish social work2016Inngår i: 6th European Conference for Social Work Research: Reflective social work practices in contemporary societies : dialogues and new pathways between praxis and research : Book of Abstracts & Prgoramme Book / [ed] Francisco Branco, Inês Amaro, Cristina Albuquerque, Maria Isabel Santos, Ana Oliveira, Inês Guerra, 2016, s. 242-243Konferansepaper (Fagfellevurdert)
    Abstract [en]

    Background

    In Sweden, as elsewhere, the development of evidence-based practice (EBP) in social work has been debated for over a decade now. One of the issues concerns the top-down strategy used by the Swedish government to enhance the knowledge about interventions in social work practice. Critiques argue that this is not a feasible way forward; instead the social work profession needs to take over the leader pin. This of course calls for structures that enable social work practitioners and researchers to engage in practice-based research in order to solve current and urgent issues. Academic primary- -care centers have been established as a possible way forward in implementing an evidence-based medicine in Swedish healthcare. Clinical research is one of the basic tasks in those centers, involving much of the personal. Here, we will reflect upon the possibilities for a similar approach within the social services. This presentation aims to present research about the conditions for new pathways between Swedish social work practice and research and to critically review the idea of academic social services offices. The following questions will be addressed:(i) What characterizes an academic social services office?(ii) What are the opinions of management in charge? (iii) What are the recommendations from research?

    Methods

    A survey was launched twice (2005 and 2015) to the leading association of administrative leaders in the social services in Sweden. Among other things they were asked about their opinions of EBP and of clinical research in social work, also if they were in the need of staff with a PhD-education. Furthermore, a review of relevant literature and expert consultations is being undertaken focusing on significant mechanisms when it comes to establishing structures in order to support the development of academic social services offices and practice-based research.

    Results

    Results from the survey show that leaders are more positive towards EBP today than ten years ago. However they are not keen on hiring staff educated in research and especially management in smaller organizations express severe difficulties to hire staff with appropriate skills and to further develop the competence to do research within their workplace. This calls for collaborations with other organizations as well as with researchers from universities and R & D-units. Results from reviews and expert-interviews will be added.

    Conclusions

    Administrative leaders support the idea of a knowledge-based social work and to use interventions whose effects are demonstrated by evaluations. However they lack strategies, competence and role-models to create a research-based organization. This paper-presentation contributes to the building of bridges between practice and research through presenting analysis of the views of management as well as innovative ways of research-production within the social services.

  • Pernow, Ylva
    et al.
    Department of Molecular Medicine and Surgery, Endocrine and Diabetes Unit, Karolinska Institutet and Karolinska University Hospital, Stockholm, Sweden.
    Shahror, Rami
    NGBI, Neuropsychiatric Research Laboratory, Faculty of Medicine and Health, School of Medical Sciences, Örebro University, Örebro, Sweden.
    Acharya, Shikha
    NGBI, Neuropsychiatric Research Laboratory, Faculty of Medicine and Health, School of Medical Sciences, Örebro University, Örebro, Sweden.
    Jahnson, Lena
    Department of Internal Medicine, Örebro University Hospital, Örebro, Sweden.
    Vumma, Ravi
    Faculty of Health and Life Sciences, Department of Chemistry and Biomedical Sciences, Linnaeus University, Kalmar, Sweden.
    Venizelos, Nikolaos
    Örebro universitet, Institutionen för medicinska vetenskaper.
    Aberrant tryptophan transport in cultured fibroblast from patients with Male Idiopathic Osteoporosis: An in vitro study2018Inngår i: Bone Reports, ISSN 2352-1872, Vol. 8, s. 25-28Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    It has been demonstrated, that long-term chronic tryptophan deficiency, results in decreased serotonin synthesis, which may lead to low bone mass and low bone formation. Findings from studies in male patients with idiopathic osteoporosis suggested a decreased transport of tryptophan in erythrocytes of osteoporotic patients, indicating that serotonin system defects may be involved in the etiology of low bone mass. Tryptophan is the precursor of serotonin, and a disturbed transport of tryptophan is implicated in altered serotonin synthesis. However, no study has investigated the tryptophan transport kinetics in MIO patients. The aim of this study is to investigate the kinetic parameters of tryptophan transport in fibroblasts derived from MIO patients compared to age and sex matched controls. Fibroblast cells were cultured from skin biopsies obtained from 14 patients diagnosed with Male Idiopathic Osteoporosis and from 13 healthy age-sex matched controls, without a diagnosis of osteoporosis. Transport of the amino acid tryptophan across the cell membrane was measured by the cluster tray method. The kinetic parameters, maximal transport capacity (Vmax) and affinity constant (Km) were determined by using the Lineweaver-Burke plot equation. The results of this study have shown a significantly lower mean value for Vmax (p = 0.0138) and lower Km mean value (p = 0.0009) of tryptophan transport in fibroblasts of MIO patients compared to the control group. A lower Vmax implied a decreased tryptophan transport availability in MIO patients. In conclusion, reduced cellular tryptophan availability in MIO patients might result in reduced brain serotonin synthesis and its endogenous levels in peripheral tissues, and this may contribute to low bone mass/formation. The findings of the present study could contribute to the etiology of idiopathic osteoporosis and for the development of novel approaches for diagnosis, treatment and management strategies of MIO.

  • Disputas: 2018-03-09 13:00 Rudbecksalen, Rudbecklaboratoriet, Uppsala
    Georganaki, Maria
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för immunologi, genetik och patologi, Vaskulärbiologi.
    Vascular targeting for enhanced cancer immunotherapy2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    Induced angiogenesis and chronic inflammation are major components of tumor immunosuppression. The scope of this thesis is to understand the role of the vasculature in anti-tumor immunity and thereby to improve cancer immunotherapy.

    The anti-tumor effects of anti-angiogenic therapies range from vessel normalization to directly affecting immune responses. In Paper I, we demonstrate that VEGF, a major pro-angiogenic factor, inhibits TNFα-induced endothelial activation via interfering with the NF-κB pathway and suppressing T-cell chemoattractants. Sunitinib, an anti-angiogenic tyrosine kinase inhibitor targeting VEGFR2 signaling, enhanced T-cell recruitment and reverted endothelial cell anergy by upregulating pro-inflammatory cytokines in murine melanomas. Therefore, in Paper II, we study the anti-tumor potential of combining sunitinib treatment with CD40-stimulating immunotherapy. CD40 activation leads to increased anti-tumor T-cell responses. The combination therapy was superior in restricting tumor growth and enhancing survival, associated with decreased immunosuppression and increased endothelial activation leading to improved T-cell recruitment. In Paper III, RNA-sequencing reveals that tumor endothelial cells are capable of acquiring negative feedback mechanisms secondary to CD40 immunotherapy by upregulating immunosuppressive genes such as IDO1. Co-administration of agonistic CD40 antibody treatment with an IDO1 inhibitor delayed tumor growth, associated with increased intratumoral T-cell activation.

    In Paper IV, we investigate ELTD1, an orphan adhesion G protein-coupled receptor, which is upregulated in high-grade glioma vessels. ELTD1 deficiency did not affect developmental angiogenesis in mice but increased tumor growth. Interestingly, ELTD1 loss improved glioma vessel perfusion and reduced permeability and hypoxia. Thus, ELTD1 targeting may normalize tumor vessels, potentially enhancing drug delivery.

    In Paper V, we demonstrate that ectopic expression of specific cytokines in murine gliomas induces tertiary lymphoid organ- (TLO-) TLO-like structures in the brain. TLOs, mainly composed of T- and B-cell clusters and high endothelial venules, are onsite preservers of robust immune responses. In line with this, increased survival of mice with gliomas overexpressing either LT-αβ or LIGHT was associated with alleviated tumor immunosuppresion. This suggests that TLO-inducing agents may improve cancer immunotherapy for glioma treatment.

    Collectively, this thesis demonstrates that the tumor vasculature is crucial for anti-tumor immune responses and that vascular targeting can enhance cancer immunotherapy.

  • Heith, Anne
    Umeå universitet, Humanistiska fakulteten, Institutionen för kultur- och medievetenskaper.
    Laestadius and Laestadianism in the contested field of cultural heritage: a study of contemporary Sámi and Tornedalian texts2018 (oppl. 1)Bok (Fagfellevurdert)
  • Elmerot, Irene
    Stockholms universitet, Humanistiska fakulteten, Institutionen för slaviska och baltiska språk, finska, nederländska och tyska, Slaviska språk.
    Language and Power in Czech Corpora2017Inngår i: Computational and Corpus-based Phraseology: Recent Advances and Interdisciplinary Approaches / [ed] Ruslan Mitkov, Genève: Editions Tradulex , 2017, Vol. 2, s. 174-177Konferansepaper (Fagfellevurdert)
    Abstract [en]

    The author focuses on quantitatively examining the linguistic other- ing in printed media discourse in the Czech Republic, using the Czech National Corpus. The method used so far has been a corpus-based discourse analysis based on the adjectives preceding the keywords for each part of the project, now moving on to include reporting verbs. The theoretical starting point is that power relations in a society are reflected in that society’s mainstream media, and that the language usage in these media contributes to the worldview of its recipients, in some cases even helps to construct it. Frequent but widely dis- persed stereotypical and negative phrases and collocations are examples of a power language that may not be visible at once, but slowly enters the general discourse in a society. This project aims to survey these linguistic othering phrases in the Czech media discourse, as comprehensively as possible, and shed some light on their appearance over time. 

  • Lennartsson, Patrik R.
    et al.
    Högskolan i Borås, Akademin för textil, teknik och ekonomi.
    Ferreira, Jorge A.
    Högskolan i Borås, Akademin för textil, teknik och ekonomi.
    Taherzadeh, Mohammad J
    Högskolan i Borås, Akademin för textil, teknik och ekonomi.
    Lundin, Magnus
    Högskolan i Borås, Akademin för textil, teknik och ekonomi.
    Gmoser, Rebecca
    Högskolan i Borås, Akademin för textil, teknik och ekonomi.
    Pigment Production by the Edible Filamentous Fungus Neurospora Intermedia2018Inngår i: Fermentation, ISSN 2311-5637, Vol. 4, nr 11, s. 1-15Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The production of pigments by edible filamentous fungi is gaining attention as a result of the increased interest in natural sources with added functionality in the food, feed, cosmetic, pharmaceutical and textile industries. The filamentous fungus Neurospora intermedia, used for production of the Indonesian food “oncom”, is one potential source of pigments. The objective of the study was to evaluate the fungus’ pigment production. The joint effect from different factors (carbon and nitrogen source, ZnCl2, MgCl2 and MnCl2) on pigment production by N. intermedia is reported for the first time. The scale-up to 4.5 L bubble column bioreactors was also performed to investigate the effect of pH and aeration. Pigment production of the fungus was successfully manipulated by varying several factors. The results showed that the formation of pigments was strongly influenced by light, carbon, pH, the co-factor Zn2+ and first- to fourth-order interactions between factors. The highest pigmentation (1.19 ± 0.08 mg carotenoids/g dry weight biomass) was achieved in a bubble column reactor. This study provides important insights into pigmentation of this biotechnologically important fungus and lays a foundation for future utilizations of N. intermedia for pigment production. 

  • Disputas: 2018-03-09 13:15 B1014, Jönköping
    Van Helvert-Beugels, Judith
    Högskolan i Jönköping, Internationella Handelshögskolan, IHH, Företagsekonomi.
    The emerging role of advisory boards in strategizing in family firms: A sensemaking perspective2018Doktoravhandling, monografi (Annet vitenskapelig)
    Abstract [en]

    This thesis addresses the emerging role of advisory boards in strategizing in privately held family firms. The thesis focuses on the period in which family firms start considering to work with an advisory board through the board’s first several years of existence. A micro-level strategy perspective is combined with insights from sensemaking theory to understand how the practitioners involved make sense of this new arena involved in strategizing. Empirically, the study is based on four real-time case studies that primarily use observations along with interviews and secondary documents. The within- and cross case interpretations are integrated into a conceptual model that explains how the roles of advisory boards in strategizing emerge over time.

    The most important finding of this study is that advisory boards emerge into unique configurations through the sensemaking activities of the practitioners involved. Moreover, this study shows that practitioners make sense of both the content that should be addressed and the role and tasks of the advisory board. This sensemaking is achieved in different ways and in different forms (individual versus mediated versus collective sensemaking), which explains the substantial differences between the advisory boards in different situations. It is suggested that the lack of an institutional frame or institutional norms provides considerable freedom in interpreting the role of the advisory boards, through which such boards largely become a contextualized practice. Two underlying causal mechanisms have been identified that drive the sensemaking processes of the practitioners involved in advisory board meetings: the learning orientation of the practitioners involved and the (a)symmetry between the advisory board members on the one hand and the family firm decision makers on the other hand.

    This dissertation contributes to our current understanding of advisory boards using a micro-level strategy lens instead of a governance lens to understand the emerging role of the advisory board in strategizing in the family firm context. This approach has helped to characterize the advising and sensemaking processes at play and how advisory boards emerge into unique configurations over time. Second, this dissertation contributes to the strategy as practice literature by devoting attention to a new arena involved in strategizing that emerges over time and the elements that play a role in this process. Instead of studying how an existing arena is performed, this study focuses on the emergence of a new strategy arena along with the practices used, the praxis performed and the practitioners involved. Thus I show how such a new arena is contextualized and becomes situated over time, attending to the processual dimensions, the content dimensions, the outcomes of the process and the outcomes generated by strategizing.

  • Deldén, Maria
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Pedagogiskt arbete. Umeå universitet, Institutionen för idé- och samhällsstudier.
    Historien som fiktion: gymnasieelevers erfarande av spelfilm i historieundervisningen2014Licentiatavhandling, monografi (Annet vitenskapelig)
    Abstract [en]

    The present study explores the reception of historical feature films in history education. It is concerned with how pupils experience the films as well as the significance of the feature film for their understanding and interpretation of history. The study incorporates empirical data from classroom projects in two different Swedish upper secondary schools where film was used as an educational tool. Observations of classroom activities were made and interviews with twelve pupils and their history teachers were conducted.

    The study applies a phenomenological approach. The lifeworld of the pupils is in focus, specifically the aspect of the lifeworld they live and experience in history class when film is used as a means of understanding the past. The phenomenon studied is thus how the pupils experience the film, and through the film, history itself. Theoretical notions from film reception studies and history didactics are used as analytic tools.

    The study shows how emotional and cognitive processes converge in the pupils’ meaning making of the films. The embodiment of the films’ narrative is an important factor that contributes to both the understanding of the film as well as of history. The pupils experience the films emotionally, feeling both empathy and antipathy for the various characters, physically through sight and sound as well as embodied reactions, and cognitively through an understanding of the film’s narrative. Embodied experience is fundamental for history to become materialized. The audiovisual portrayal and materialization of the past becomes embodied in the pupils so that the experience of the film and of the historical lifeworld presented therein becomes part of their lifeworld. Generally, pupils consider the films to be trustworthy, though this perceived accuracy depends on how authentically the narrative is performed and the pupils’ previous store of historical knowledge. 

    A didactic dilemma to consider when using historical feature film in the classroom is the contradiction between the aesthetic experience of a feature film and its use as a tool for understanding the past. The captivating character of feature film evokes empathy and engagement with the films’ characters regardless of the degree of historical accuracy. This is a critical issue for teachers; there needs to be balance between respect for the pupils’ aesthetic experience of the film and the need to guide them to develop for example the skills of historical empathy, where distance is necessary for the pupils to be able to consider different perspectives.

  • Deldén, Maria
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Pedagogiskt arbete. Umeå universitet, Institutionen för idé- och samhällsstudier.
    Det räcker inte att bara visa en film: Historisk spelfilm i undervisningen2016Inngår i: Medier i historieundervisningen: Historiedidaktisk forskning i praktiken / [ed] Anna Larsson, Umeå: Institutionen för idé- och samhällsstudier, Umeå universitet , 2016, 1, s. 179-195Kapittel i bok, del av antologi (Annet vitenskapelig)
  • Deldén, Maria
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Pedagogiskt arbete. Umeå universitet, Institutionen för idé- och samhällsstudier.
    ¿La ficción para qué?: Literacidad de películas históricas2017Inngår i: Caminos de la enseñanza de la historia / [ed] Paulina Lapatí Escalante, José Carlos Blázquez Espinosa, Siddharta Camargo Arteaga, Querétaro, México, 2017, s. 1242-1259Konferansepaper (Fagfellevurdert)
    Abstract [es]

    El texto se basa en mi tesis doctoral, Elcine como herramienta didáctica. Investigo el sentidohistórico creado a partir de las películas históricas. Laspelículas históricas forman parte de la cultura histórica,como una memoria cultural. Basándome en el filósofohistórico alemán Jörn Rüsen exploro cómo podemoscrear sentido a la historia mediada por el lenguajedel cine. Utilizo entrevistas con jóvenes, como ‘sociosde un diálogo crítico’, donde los jóvenes expresan susexperiencias de películas históricas. Pongo las vocesde los jóvenes a dialogar con teorías de las didácticasde la historia y teorías del cine. Llego a la teorizacióndel concepto de la literacidad de películas históricas(historical film literacy). Una conclusión sobre la literacidadcine-historia para crear sentido a la historia esque se trata de una fusión holística entre la emocióny la cognición, donde la dialéctica entre ambas es lovital. La experiencia del cine en el espectador la nombrovaloración emocional, con el significado de que sebasa en sentimientos básicos combinados con pensamientosde carácter más abstracto, de valor o juicio.La perspectiva crítica es importante dado que el sentidohistórico también tiene que ver con la dialécticapasado - presente - futuro, y la consciencia históricadel ser humano.

  • Deldén, Maria
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Pedagogiskt arbete. Umeå universitet, Institutionen för idé- och samhällsstudier.
    Las películas históricas, la narración y la recepción de los alumnos2015Inngår i: La historia enseñada a discusión: Retos epistemológicos y perspectivas didácticas / [ed] Barajas Trejo, Dení; Martínez Villa, Juana, Morelia, Michoacán, México: D.R. Universidad Michoacana de San Nicolás de Hidalgo, Instituto de Investigaciones Históricas , 2015, s. 905-922Konferansepaper (Annet vitenskapelig)
    Abstract [es]

    En la enseñanza de la historia a veces se emplean películas históricas de cine como parte del uso de los medios en la enseñanza; como un material didáctico que visualiza el pasado. El uso de estos medios para el aprendizaje del pasado genera preguntas importantes. En esta ponencia primero se resalta la recepción entre los alumnos, de películas de temática histórica, cuando las películas fueron utilizadas como herramienta didáctica en la enseñanza de la historia. En un estudio empírico he investigado el proceso de crear sentido, que realizan los alumnos en la experiencia de películas históricas. El estudio señala una convergencia entre procesos cognitivos y emocionales donde la empatía es un factor importante que aporta al aprendizaje histórico y al entendimiento narrativo. La ponencia llega a reflexionar sobre la noción de empatía y como se relaciona la misma con la empatía histórica; así mismo problematizo el dilema didáctico frente al uso de películas históricas en la enseñanza.

    La segunda parte de la ponencia mira la película histórica y el uso, en la perspectiva de la memoria cultural y con la ayuda de la metáfora del palimpsesto. Llego a la conclución de que precisamente en la interacción entre realidad, ficción y la creación de sentido se encuentran las posibilidades didácticas interesantes y desafiantes. Podemos mirar la potencial de la película con la ayuda de la metáfora del palimpsesto – una potencial que posee justamente por las capas de realidad y ficción y de pasado y presente.

  • Deldén, Maria
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Pedagogiskt arbete. Umeå universitet, Institutionen för idé- och samhällsstudier.
    The Teacher and Educational Spaces: The Photograph as a Tool for Teacher Reflection2014Inngår i: Engaging with Educational Space: Visualizing Spaces of Teaching and Learning / [ed] Catherine Burke, Ian Grosvenor & Björn Norlin, Umeå: Institutionen för idé- och samhällsstudier , 2014, s. 51-59Kapittel i bok, del av antologi (Annet vitenskapelig)
  • Disputas: 2018-03-09 13:15 Polhemssalen, Ångströmlaboratoriet, Uppsala
    Thörnblad, Erik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Matematisk-datavetenskapliga sektionen, Matematiska institutionen.
    Degrees in Random Graphs and Tournament Limits2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    This thesis consists of an introduction and six papers on the topics of degree distributions in random graphs and tournaments and their limits.

    The first two papers deal with a dynamic random graph, evolving in time through duplication and deletion of vertices and edges. In Paper I we study the degree densities of this model. We show that these densities converge almost surely and determine their limiting values exactly as well as asymptotically for large degrees. In Paper II we study the evolution of the maximum degree and provide a precise growth rate thereof.

    Paper III deals with a dynamic random tree model known as the vertex-splitting tree model. We show that the degree densities converge almost surely and find an infinite linear system of equations which they must satisfy. Unfortunately we are not able to show that this system has a unique solution except in special cases.

    Paper IV is about self-converse generalised tournaments. A self-converse generalised tournament can be seen as a matrix whose entries take values in [0,1] and whose diagonally opposite elements sum to 1. We characterise completely the marginals of such a matrix, and show that such marginals can always be realised by a self-converse generalised tournament.

    In Paper V, we define and develop the theory of tournament limits and tournament kernels. We characterise transitive and irreducible tournament limits and kernels, and prove that any tournament limit and kernel has an essentially unique decomposition into irreducible tournament limits or kernels interlaced by a transitive part.

    In Paper VI, we study the degree distributions of tournament limits, or equivalently, the marginals of tournament kernels. We describe precisely which distributions on [0,1] which may appear as degree distributions of tournament limits and which functions from [0,1] to [0,1] may appear as the marginals of tournament kernels. Moreover, we show that any distribution or marginal on this form may be realised by a tournament limit or tournament kernel. We also study those distributions and marginals which can be realised by a unique tournament limit or kernel, and find that only the transitive tournament limit/kernel gives rise to a degree distribution or marginal with this property.

  • Samstarvsætlan Norðurlendska ráðharraráðsins fyri yrkislívið 2018-20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [fo]

    Felags arbeiðsmarknaðurin er ein hornasteinur í norðurlendska samstarvinum. Ein stór og væl útbúgvin arbeiðsmegi er týdningarmesta tilfeingi okkara, sum leggur lunnar undir ein kappingarføran norðurlendskan arbeiðsmarknað og menningina av norðurlendsku vælferðarsamfeløgunum.

    Á norðurlendska arbeiðsmarknaðinum standa tó nógvar broytingar fyri durum sum avleiðing til dømis av broytingum í fólkasamansetingini, øktari altjóðagerð, tøkniligari menning og altjóða kapping.

    Samstarvsætlanin fyri yrkislívið 2018-2021 vísir á mangar av hesum týðandi avbjóðingunum á økinum og lýsir, hvønn leiklut norðurlendska samstarvið kann fáa, tá ið tikið verður við hesum avbjóðingum.

  • Nordisk ministerråds samarbeidsprogram for arbeidsliv 2018–20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [no]

    Et felles arbeidsmarked utgjør en hjørnestein i det nordiske samarbeidet. En stor og kompetent arbeidsstyrke er vår viktigste ressurs og danner grunnlag både for et konkurransedyktig nordisk arbeidsmarked og for utviklingenav de nordiske velferdssamfunnene.

    Samtidig står de nordiske arbeidsmarkedene overfor betydelige endringer som følge av bl.a. demografisk utvikling, økt globalisering, teknologisk utvikling og internasjonal konkurranse.

    Samarbeidsprogrammet for arbeidsliv 2018–2021 peker på en rekke vesentlige utfordringer på arbeidslivsområdet og hvordan det nordiske samarbeidet kan bidra til å møte disse.

  • Programme for the Nordic Council of Ministers’ Co-operation on Labour 2018-20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [en]

    The common labour market comprises a cornerstone in the Nordic co-operation. A large, skilled workforce is our most important resource, and forms the foundation for a competitive Nordic labour market and for development ofthe Nordic welfare societies.

    At the same time, the Nordic labour markets are facing major changes because of, for example, demographic change, increased globalisation, technological development, and international competition.

    The co-operation programme on labour 2018-2021 identifies several important challenges relating to the labour sector, and shows how the Nordic co-operation can help to address these.

  • Nordisk Ministerråds samarbejdsprogram for arbejdsliv 2018-20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [da]

    Det fælles arbejdsmarked er en af hjørnestenene i det nordiske samarbejde. En stor og kompetent arbejdsstyrke er vores vigtigste ressource, og den danner grundlaget for et konkurrencedygtigt nordisk arbejdsmarked og for udviklingen af de nordiske velfærdssamfund.

    Samtidig står de nordiske arbejdsmarkeder over for betydelige forandringer som følge af blandt andet den demografiske udvikling, øget globalisering, teknologisk udvikling og international konkurrence.

    Samarbejdsprogrammet for arbejdsliv 2018-2021 peger på en række af disse væsentlige udfordringer på arbejdslivsområdet og beskriver, hvordan det nordiske samarbejde kan bidrage til at løse dem.

  • Samstarfsáætlun Norrænu ráðherranefndarinnar í vinnumálum 2018–20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [is]

    Sameiginlegur vinnumarkaður er hornsteinn norræns samstarfs. Fjölmennt og hæft vinnuafl er mikilvægasta auðlind okkar og leggur grunninn að samkeppnishæfum norrænum vinnumarkaði og þróun norrænu velferðarþjóðfélaganna.

    Á sama tíma stendur norrænn vinnumarkaður frammi fyrir verulegum breytingum í kjölfar meðal annars lýðfræðilegrar þróunar, aukinnar hnattvæðingar, tækniþróunar og alþjóðlegrar samkeppni.

    Samstarfsáætlunin í vinnumálum árin 2018–2021 tilgreinir nokkrar verulegar áskoranir í atvinnumálum og hvernig norrænt samstarf getur stuðlað að úrlausn þeirra.

  • Westgård, Theresa
    et al.
    Ottenvall Hammar, Isabelle
    Holmgren, Eva
    Ehrenberg, Anna
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Omvårdnad.
    Wisten, Aase
    Ekdahl, Anne W
    Dahlin-Ivanoff, Synneve
    Wilhelmson, Katarina
    Comprehensive geriatric assessment pilot of a randomized control study in a Swedish acute hospital: a feasibility study2018Inngår i: Pilot and feasibility studies, ISSN 2055-5784, Vol. 4, artikkel-id 41Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Background: Comprehensive geriatric assessment (CGA) represent an important component of geriatric acute hospital care for frail older people, secured by a multidisciplinary team who addresses the multiple needs of physical health, functional ability, psychological state, cognition and social status. The primary objective of the pilot study was to determine feasibility for recruitment and retention rates. Secondary objectives were to establish proof of principle that CGA has the potential to increase patient safety.

    Methods: The CGA pilot took place at a University hospital in Western Sweden, from March to November 2016, with data analyses in March 2017. Participants were frail people aged 75 and older, who required an acute admission to hospital. Participants were recruited and randomized in the emergency room. The intervention group received CGA, a person-centered multidisciplinary team addressing health, participation, and safety. The control group received usual care. The main objective measured the recruitment procedure and retention rates. Secondary objectives were also collected regarding services received on the ward including discharge plan, care plan meeting and hospital risk assessments including risk for falls, nutrition, decubitus ulcers, and activities of daily living status.

    Result: Participants were recruited from the emergency department, over 32 weeks. Thirty participants were approached and 100% (30/30) were included and randomized, and 100% (30/30) met the inclusion criteria. Sixteen participants were included in the intervention and 14 participants were included in the control. At baseline, 100% (16/16) intervention and 100% (14/14) control completed the data collection. A positive propensity towards the secondary objectives for the intervention was also evidenced, as this group received more care assessments. There was an average difference between the intervention and control in occupational therapy assessment - 0.80 [95% CI 1.06, - 0.57], occupational therapy assistive devices - 0.73 [95% CI 1.00, - 0.47], discharge planning -0.21 [95% CI 0.43, 0.00] and care planning meeting 0.36 [95% CI-1.70, -0.02]. Controlling for documented risk assessments, the intervention had for falls - 0.94 [95% CI 1.08, - 0.08], nutrition - 0.87 [95% CI 1.06, - 0.67], decubitus ulcers - 0.94 [95% CI 1.08, - 0.80], and ADL status - 0.80 [95% CI 1.04, - 0.57].

    Conclusion: The CGA pilot was feasible and proof that the intervention increased safety justifies carrying forward to a large-scale study.

    Trial registration: Clinical Trials ID: NCT02773914. Registered 16 May 2016.

  • Pohjoismaiden ministerineuvoston työelämäalan yhteistyöohjelma 2018–20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [fi]

    Yhteiset työmarkkinat ovat pohjoismaisen yhteistyön kulmakivi. Laaja ja osaava työvoima on tärkein voimavaramme, joka luo pohjan kilpailukykyisille pohjoismaisille työmarkkinoille sekä pohjoismaisten hyvinvointiyhteiskuntien kehitykselle.

    Samalla pohjoismaisilla työmarkkinoilla on edessä huomattavia muutoksia muun muassa väestönkehityksen, lisääntyvän globalisaation, teknologian ja kansainvälisen kilpailun seurauksena.

    Työelämäalan yhteistyöohjelma 2018–2021 nostaa esiin olennaisia työelämään liittyviä haasteita ja tarjoaa keinoja niiden ratkaisemiseksi pohjoismaisen yhteistyön avulla.

  • Björkelund, Cecilia
    et al.
    Svenningsson, Irene
    Hange, Dominique
    Udo, Camilla
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Socialt arbete.
    Petersson, Eva-Lisa
    Ariai, Nashmil
    Nejati, Shabnam
    Wessman, Catrin
    Wallin, Lars
    Högskolan Dalarna, Akademin Utbildning, hälsa och samhälle, Omvårdnad. Göteborgs universitet; Karolinska institutet.
    Westman, Jeanette
    Clinical effectiveness of care managers in collaborative care for patients with depression in Swedish primary health care: a pragmatic cluster randomized controlled trial.2018Inngår i: BMC Family Practice, ISSN 1471-2296, E-ISSN 1471-2296, Vol. 19, nr 1, artikkel-id 28Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    BACKGROUND: Depression is one of the leading causes of disability and affects 10-15% of the population. The majority of people with depressive symptoms seek care and are treated in primary care. Evidence internationally for high quality care supports collaborative care with a care manager. Our aim was to study clinical effectiveness of a care manager intervention in management of primary care patients with depression in Sweden.

    METHODS: In a pragmatic cluster randomized controlled trial 23 primary care centers (PCCs), urban and rural, included patients aged ≥ 18 years with a new (< 1 month) depression diagnosis. Intervention consisted of Care management including continuous contact between care manager and patient, a structured management plan, and behavioral activation, altogether around 6-7 contacts over 12 weeks. Control condition was care as usual (CAU).

    OUTCOME MEASURES: Depression symptoms (measured by Mongomery-Asberg depression score-self (MADRS-S) and BDI-II), quality of life (QoL) (EQ-5D), return to work and sick leave, service satisfaction, and antidepressant medication. Data were analyzed with the intention-to-treat principle.

    RESULTS: One hundred ninety two patients with depression at PCCs with care managers were allocated to the intervention group, and 184 patients at control PCCs were allocated to the control group. Mean depression score measured by MADRS-S was 2.17 lower in the intervention vs. the control group (95% CI [0.56; 3.79], p = 0.009) at 3 months and 2.27 lower (95% CI [0.59; 3.95], p = 0.008) at 6 months; corresponding BDI-II scores were 1.96 lower (95% CI [- 0.19; 4.11], p = 0.07) in the intervention vs. control group at 6 months. Remission was significantly higher in the intervention group at 6 months (61% vs. 47%, p = 0.006). QoL showed a steeper increase in the intervention group at 3 months (p = 0.01). During the first 3 months, return to work was significantly higher in the intervention vs. the control group. Patients in the intervention group were more consistently on antidepressant medication than patients in the control group.

    CONCLUSIONS: Care managers for depression treatment have positive effects on depression course, return to work, remission frequency, antidepressant frequency, and quality of life compared to usual care and is valued by the patients.

    TRIAL REGISTRATION: Identifier: NCT02378272 . February 2, 2015. Retrospectively registered.

  • Viktorsson, Lena
    et al.
    SMHI, Samhälle och säkerhet.
    Wesslander, Karin
    SMHI, Samhälle och säkerhet.
    Revidering av fysikaliska och kemiskabedömningsgrunder i kustvatten: Underlag inför uppdatering av HVMFS 2013:192018Rapport (Annet vitenskapelig)
    Abstract [sv]

    Detta är ett underlag för revidering av bilaga 5 i HVMFS 2013:19, Bedömningsgrunder för fysikaliskkemiskakvalitetsfaktorer i kustvatten och vatten i övergångszonen. Underlaget innefattar främst enuppdatering av referensvärden för näringsämnen samt förslag på uppdatering av viss text i föreskriftengällande syrebalans och siktdjup. Den generella metoden för var och en av stödparametrarna ibedömningsgrunderna bibehålls. I rapportens sista kapitel presenteras de uppdateringar av föreskriftenHVMFS 2013:19 som rekommenderas utifrån detta uppdrag.Efter en jämförelse av tidigare framtagna referensvärden för näringsämnen och de som tagits fram iden här rapporten rekommenderas att nya referensvärden i tillrinnande sötvatten används men atttidigare referensvärden för TN och TP vid utsjösalthalt samt att klassgränser behålls. En mindrejustering av referensvärden för DIN och DIP utifrån havsmiljöförordningens G/M värden föreslåsdock. De nya referensvärdena är framtagna med modellen S-HYPE (Lindström m.fl. 2010) förtillrinnande sötvatten och utifrån utsjövärden för oorganiskt fosfor och kväve (HVMFS 2012:18) samteffektsamband i mätdata. Det förtydligas också att ett konstant referensvärde för näringsämnenanvänds vid salthalter ≤2 psu.Den S-HYPE körning som använts för referensvärden i tillrinnande sötvatten är en bakgrundskörningsom är anpassad till definitionen av bakgrundsbelastning i PLC6 (Pollution Load Compilation 6,HELCOM).Utöver uppdatering av referensvärden för näringsämnen så föreslås en förändrad sammanvägning avkväve och fosfor i bedömningsgrunden. Det innebär att de ingående parametrarna för kväve och fosforsammanvägs var för sig. Bedömningsgrunderna ger då en separat status för varje näringsämne (kväveoch fosfor) baserat på de ingående parametrarna. Detta ger både en större möjlighet till att se vilketnäringsämne som bidrar till att eventuellt sänka status och stämmer överens med hur rapporteringentill EU-kommissionen ska ske.För syre rekommenderas en uppdatering om vilka mätmetoder som får användas, så att ävenmätningar med sensorer kan användas för statusbedömning. För siktdjup var ambitionen att ta fram etthumusgränsvärde för när kvalitetsfaktorn inte ska tillämpas. En fullständig statistisk analys har intehunnits med och en tydlig rekommendation kan inte ges.Det har under arbetet med att ta fram nya referensvärden för näringsämnen enligt nuvarande metodblivit tydligt att metoden för att bedöma näringsämnen behöver en mer övergripande uppdatering. Tillexempel kan metoden för salthaltskorrektion troligen förbättras med hjälp av en analys av mätdata ikombination med kustzonsmodellen.

  • Nordiska ministerrådets samarbetsprogram för arbetsliv 2018–20212018Annet (Annet (populærvitenskap, debatt, mm))
    Abstract [sv]

    Den gemensamma arbetsmarknaden utgör en hörnsten i det nordiska samarbetet. En stor och kompetent arbetsstyrka är vår viktigaste resurs och formar grunden för en konkurrensstark nordisk arbetsmarknad samt för utvecklingen av de nordiska välfärdssamhällena. Samtidigt står de nordiska arbetsmarknaderna inför betydande förändringar till följd av bl.a. demografisk utveckling, ökad globalisering, teknologi och internationell konkurrens. Samarbetsprogrammet för arbetslivssektorn 2018-2021 pekar ut en rad väsentliga utmaningar inom arbetslivsområdet och hur det nordiska samarbetet kan bidra till att tillmötesgå dessa.

  • Petrulevich, Alexandra
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Språkvetenskapliga fakulteten, Institutionen för nordiska språk, Seminariet för nordisk namnforskning.
    ”Utländskt”, ”inhemskt” och ortnamnsanpassning: Finns det universella anpassningsprinciper?2017Inngår i: Namn og Nemne: Tidsskrift for norsk namnegransking, ISSN 0800-4684, Vol. 34, s. 67-91Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The aim of the article is to set adaptation of replicated place names (loaned names in traditional terminology) in a larger perspective by exploring a number of ways of conceptualising and studying the phenomenon within contact onomastics and contact linguistics. Many of the inquiries into this topic are deeply-rooted in settlement history, but I would like to open up for an option of a primarily linguistic investigation of place name adaptation as a process that in many ways resembles that of so called toponymic analogy. I see place name replication and place name adaptation as two different although related processes, a theoretical stance explored and built on in my doctoral thesis (2016), which forms a frame work for the present study. According to my definition of place name adaptation the difference between “native” and replicated place names can be said to disappear once the replication process is completed, because all place names irrespective of their etymology follow the development of the target language. There is however always a possibility of semantically adapting replicated place names in the long run which comprises one of the factors working against complete equivalence of “native” and replicated names. In the article I present some research opportunities revealed once the difference between “native” and replicated place names no longer is the sole matter of investigation.

  • Mathews, Elezebeth
    et al.
    Sree Chitra Tirunal Inst Med Sci & Technol, Achutha Menon Ctr Hlth Sci Studies, Thiruvananthapuram, Kerala, India.;Cent Univ Kerala, Dept Publ Hlth & Community Med, Kasaragod, Kerala, India..
    Thomas, Emma
    Univ Melbourne, Melbourne Sch Populat & Global Hlth, Melbourne, Vic, Australia..
    Absetz, Pilvikki
    Univ Eastern Finland, Dept Publ Hlth & Clin Nutr, Kuopio, Finland.;Univ Tampere, Sch Hlth Sci, Tampere, Finland.;Collaborat Care Syst Finland, Helsinki, Finland..
    D'Esposito, Fabrizio
    Univ Melbourne, Melbourne Sch Populat & Global Hlth, Melbourne, Vic, Australia..
    Aziz, Zahra
    Univ Melbourne, Melbourne Sch Populat & Global Hlth, Melbourne, Vic, Australia..
    Balachandran, Sajitha
    Sree Chitra Tirunal Inst Med Sci & Technol, Achutha Menon Ctr Hlth Sci Studies, Thiruvananthapuram, Kerala, India..
    Daivadanam, Meena
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Samhällsvetenskapliga fakulteten, Institutionen för kostvetenskap. Karolinska Inst, Dept Publ Hlth Sci, Stockholm, Sweden..
    Thankappan, Kavumpurathu Raman
    Sree Chitra Tirunal Inst Med Sci & Technol, Achutha Menon Ctr Hlth Sci Studies, Thiruvananthapuram, Kerala, India..
    Oldenburg, Brian
    Univ Melbourne, Melbourne Sch Populat & Global Hlth, Melbourne, Vic, Australia..
    Cultural adaptation of a peer-led lifestyle intervention program for diabetes prevention in India: the Kerala diabetes prevention program (K-DPP)2018Inngår i: BMC Public Health, ISSN 1471-2458, E-ISSN 1471-2458, Vol. 17, artikkel-id 974Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Background: Type 2 diabetes mellitus (T2DM) is now one of the leading causes of disease-related deaths globally. India has the world's second largest number of individuals living with diabetes. Lifestyle change has been proven to be an effective means by which to reduce risk of T2DM and a number of "real world" diabetes prevention trials have been undertaken in high income countries. However, systematic efforts to adapt such interventions for T2DM prevention in low-and middle-income countries have been very limited to date. This research-to-action gap is now widely recognised as a major challenge to the prevention and control of diabetes. Reducing the gap is associated with reductions in morbidity and mortality and reduced health care costs. The aim of this article is to describe the adaptation, development and refinement of diabetes prevention programs from the USA, Finland and Australia to the State of Kerala, India.

    Methods: The Kerala Diabetes Prevention Program (K-DPP) was adapted to Kerala, India from evidence-based lifestyle interventions implemented in high income countries, namely, Finland, United States and Australia. The adaptation process was undertaken in five phases: 1) needs assessment; 2) formulation of program objectives; 3) program adaptation and development; 4) piloting of the program and its delivery; and 5) program refinement and active implementation.

    Results: The resulting program, K-DPP, includes four key components: 1) a group-based peer support program for participants; 2) a peer-leader training and support program for lay people to lead the groups; 3) resource materials; and 4) strategies to stimulate broader community engagement. The systematic approach to adaptation was underpinned by evidence-based behavior change techniques.

    Conclusion: K-DPP is the first well evaluated community-based, peer-led diabetes prevention program in India. Future refinement and utilization of this approach will promote translation of K-DPP to other contexts and population groups within India as well as other low-and middle-income countries. This same approach could also be applied more broadly to enable the translation of effective non-communicable disease prevention programs developed in high-income settings to create context-specific evidence in rapidly developing low-and middle-income countries.

  • Feltmann, Kristin
    et al.
    Karolinska Inst, Dept Clin Neurosci, Ctr Psychiat Res, Stockholm, Sweden.;Stockholm Cty Council, Stockholm Hlth Care Serv, Stockholm, Sweden..
    Giuliano, Chiara
    Univ Cambridge, Dept Psychol, Cambridge, England.;Univ Cambridge, Behav & Clin Neurosci Inst, Cambridge, England..
    Everitt, Barry J.
    Univ Cambridge, Dept Psychol, Cambridge, England.;Univ Cambridge, Behav & Clin Neurosci Inst, Cambridge, England..
    Steensland, Pia
    Karolinska Inst, Dept Clin Neurosci, Ctr Psychiat Res, Stockholm, Sweden.;Stockholm Cty Council, Stockholm Hlth Care Serv, Stockholm, Sweden..
    Alsiö, Johan
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap. Univ Cambridge, Dept Psychol, Cambridge, England.; Univ Cambridge, Behav & Clin Neurosci Inst, Cambridge, England..
    The Effects of the Monoamine Stabilizer (-)-OSU6162 on Binge-Like Eating and Cue-Controlled Food-Seeking Behavior in Rats2018Inngår i: Neuropsychopharmacology, ISSN 0893-133X, E-ISSN 1740-634X, Vol. 43, nr 3, s. 617-626Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Binge-eating disorder (BED) is characterized by recurring episodes of excessive consumption of palatable food and an increased sensitivity to food cues. Patients with BED display an addiction-like symptomatology and the dopamine system might be a potential treatment target. The clinically safe monoamine stabilizer (-)-OSU6162 (OSU6162) restores dopaminergic dysfunction in long-term alcohol-drinking rats and shows promise as a novel treatment for alcohol use disorder. Here, the effects of OSU6162 on consummatory (binge-like eating) and appetitive (cue-controlled seeking) behavior motivated by chocolate-flavored sucrose pellets were evaluated in non-food-restricted male Lister Hooded rats. OSU6162 significantly reduced binge-like intake of chocolate-flavored sucrose pellets without affecting prior chow intake. Furthermore, OSU6162 significantly reduced the cue-controlled seeking of chocolate-flavored sucrose pellets under a second-order schedule of reinforcement before, but not after, the delivery and ingestion of reward, indicating a selective effect on incentive motivational processes. In contrast, the dopamine D2/D3 receptor antagonist raclopride reduced the seeking of chocolate-flavored sucrose pellets both pre-and post reward ingestion and also reduced responding under simpler schedules of seeking behavior. The D1/5 receptor antagonist SCH23390 had no effect on instrumental behavior under any reinforcement schedule tested. Finally, local administration of OSU6162 into the nucleus accumbens core, but not dorsolateral striatum, selectively reduced cue-controlled sucrose seeking. In conclusion, the present results show that OSU6162 reduces binge-like eating behavior and attenuates the impact of cues on seeking of palatable food. This indicates that OSU6162 might serve as a novel BED medication.

  • Talla, Venkat
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Evolutionsbiologi.
    Suh, Alexander
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Evolutionsbiologi.
    Kalsoom, Faheema
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Evolutionsbiologi.
    Dinca, Vlad
    Inst Biol Evolut CSIC UPF, Anim Biodivers & Evolut Program, Barcelona, Spain..
    Vila, Roger
    Inst Biol Evolut CSIC UPF, Anim Biodivers & Evolut Program, Barcelona, Spain..
    Friberg, Magne
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Växtekologi och evolution.
    Wiklund, Christer
    Stockholm Univ, Div Ecol, Dept Zool, Stockholm, Sweden..
    Backström, Niclas
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Evolutionsbiologi.
    Rapid Increase in Genome Size as a Consequence of Transposable Element Hyperactivity in Wood-White (Leptidea) Butterflies2017Inngår i: Genome Biology and Evolution, ISSN 1759-6653, E-ISSN 1759-6653, Vol. 9, nr 10, s. 2491-2505Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Characterizing and quantifying genome size variation among organisms and understanding if genome size evolves as a consequence of adaptive or stochastic processes have been long-standing goals in evolutionary biology. Here, we investigate genome size variation and association with transposable elements (TEs) across lepidopteran lineages using a novel genome assembly of the common wood-white (Leptidea sinapis) and population re-sequencing data from both L. sinapis and the closely related L. reali and L. juvernica together with 12 previously available lepidopteran genome assemblies. A phylogenetic analysis confirms established relationships among species, but identifies previously unknown intraspecific structure within Leptidea lineages. The genome assembly of L. sinapis is one of the largest of any lepidopteran taxon so far (643Mb) and genome size is correlated with abundance of TEs, both in Lepidoptera in general and within Leptidea where L. juvernica from Kazakhstan has considerably larger genome size than any other Leptidea population. Specific TE subclasses have been active in different Lepidoptera lineages with a pronounced expansion of predominantly LINEs, DNA elements, and unclassified TEs in the Leptidea lineage after the split from other Pieridae. The rate of genome expansion in Leptidea in general has been in the range of four Mb/Million year (My), with an increase in a particular L. juvernica population to 72Mb/My. The considerable differences in accumulation rates of specific TE classes in different lineages indicate that TE activity plays a major role in genome size evolution in butterflies and moths.

  • Al-Ani, Thair
    et al.
    Geological Survey of Finland (GTK), Espoo.
    Ahtola, Timo
    Geological Survey of Finland (GTK), Espoo.
    Kuusela, Janne
    Geological Survey of Finland (GTK), Espoo.
    Al-Ansari, Nadhir
    Luleå tekniska universitet, Institutionen för samhällsbyggnad och naturresurser, Geoteknologi.
    Mineralogical and Petrographic Characteristics of Indium and REE-Bearing Accessory Phases in the Kymi Granite Stock, Southern Finland2018Inngår i: Natural Resources, ISSN 2158-706X, E-ISSN 2158-7086, Vol. 9, nr 2, s. 23-41, artikkel-id 82556Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The Wiborg rapakivi batholith (1.64 Ga) in southeastern Finland with docu-mented occurrences of REE, indium and Zn-Cu-Pb sulphide mineralization was studied. Hydrothermal greisen and quartz vein type Fe-Sn and Zn-Cu-Pb are found in the Kymi granite stock as intrusions. They are enriched with in-dium and rare earth elements, with roquesite (CuInS2) being a major indium- carrier, whereas monazite (Ce), allanite (Ce), bastnäesite (Ce), xenotime-(Y) and thorite are the main REE carriers. Combination of optical and field emis-sion scanning electron microscopy (FE-SEM) and electron probe microanaly-sis (EPMA) were used to study the indium and REE-bearing mineral assem-blages. EPMA of roquesite found in galena had a composition of 26.16% S, 0.02% Fe, 25.06% Cu, 0.03% Zn, 1.06% As, 0.31% Sb and 47.14% In. Substitu-tion reaction Pb2+S2− ↔ Cu+In3+S2− is the cause of the incorporation of indium in the galena structure. The majority of the LREE are carried by monazite, bastnäesite and allanite, and the HREE by xenotime and zircon. There is a partial solid solution between monazite and xenotime with minor or trace amounts of LREE in xenotime grains (6.0 wt%). LREE (>95 mol% LREE) and less than 5 mol% HREE + Y reflects the enrichment of chondrite-normalized REE of the monazite grains of the Kymi granite stock. The xenotime grains (small and irregular) main composition contains 71 - 76 mol% YPO4, 16 - 27 mol% HREE, and 6 - 8 mol% LREE. It is believed that indium and REE-mineralization presence is due to the combination of magmatic and postmagmatic processes, particularly at later stages by fluid fractionation.

  • Helgesson, Gert
    et al.
    Karolinska Inst, Dept Learning Informat Management & Eth, Stockholm Ctr Healthcare Eth CHE, Stockholm, Sweden..
    Bertilsson, Göran
    Swedish Agcy Hlth Technol Assessment Assessment So, Stockholm, Sweden..
    Domeij, Helena
    Swedish Agcy Hlth Technol Assessment Assessment So, Stockholm, Sweden..
    Fahlström, Gunilla
    Swedish Agcy Hlth Technol Assessment Assessment So, Stockholm, Sweden..
    Heintz, Emelie
    Swedish Agcy Hlth Technol Assessment Assessment So, Stockholm, Sweden.;Karolinska Inst, Med Management Ctr, Dept Learning Informat Management & Eth, Stockholm, Sweden..
    Hjern, Anders
    Karolinska Inst, Dept Med, Clin Epidemiol, Stockholm, Sweden.;Ctr Hlth Equ Studies, Stockholm, Sweden..
    Nehlin, Christina
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Psykiatri, Akademiska sjukhuset.
    Nordin, Viviann
    Karolinska Inst KIND, Ctr Neurodev Disorders, Stockholm, Sweden..
    Rangmar, Jenny
    Univ Gothenburg, Dept Psychol, Gothenburg, Sweden..
    Rydell, Ann-Margret
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Samhällsvetenskapliga fakulteten, Institutionen för psykologi.
    Sundelin Wahlsten, Viveka
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Barn- och ungdomspsykiatri.
    Hultcrantz, Monica
    Swedish Agcy Hlth Technol Assessment Assessment So, Stockholm, Sweden.;Karolinska Inst, Dept Learning Informat Management & Eth, Stockholm, Sweden..
    Ethical aspects of diagnosis and interventions for children with fetal alcohol Spectrum disorder (FASD) and their families2018Inngår i: BMC Medical Ethics, ISSN 1472-6939, E-ISSN 1472-6939, Vol. 19, artikkel-id 1Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Background: Fetal alcohol spectrum disorders (FASD) is an umbrella term covering several conditions for which alcohol consumption during pregnancy is taken to play a causal role. The benefit of individuals being identified with a condition within FASD remains controversial. The objective of the present study was to identify ethical aspects and consequences of diagnostics, interventions, and family support in relation to FASD.

    Methods: Ethical aspects relating to diagnostics, interventions, and family support regarding FASD were compiled and discussed, drawing on a series of discussions with experts in the field, published literature, and medical ethicists.

    Results: Several advantages and disadvantages in regards of obtaining a diagnosis or description of the condition were identified. For instance, it provides an explanation and potential preparedness for not yet encountered difficulties, which may play an essential role in acquiring much needed help and support from health care, school, and the socia ! services. There are no interventions specifically evaluated for FASD conditions, but training programs and family support for conditions with symptoms overlapping with FASD, e.g. ADHD, autism, and intellectual disability, are likely to be relevant. Stigmatization, blame, and guilt are potential downsides. There might also be unfortunate prioritization if individuals with equal needs are treated differently depending on whether or not they meet the criteria for a specific condition. Conclusions: The value for the concerned individuals of obtaining a FASD-related description of their condition - for instance, in terms of wellbeing - is not established. Nor is it established that allocating resources based, on whether individuals fulfil FASD-related criteria is justified, compared to allocations directed to the most prominent specific needs.

  • Weiberg, Erika
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Historisk-filosofiska fakulteten, Institutionen för arkeologi och antik historia, Antikens kultur och samhällsliv.
    Samhällsomdaning – kris,kollaps eller möjlighet?2017Inngår i: Statsvetenskaplig Tidskrift, ISSN 0039-0747, Vol. 119, nr 2, s. 315-328Artikkel i tidsskrift (Fagfellevurdert)
  • Disputas: 2018-03-09 10:00 Nordenskiöldsalen, Geovetenskapens hus, Stockholm
    Hendrickx, Koen
    Stockholms universitet, Naturvetenskapliga fakulteten, Meteorologiska institutionen (MISU).
    Solar Forcing of Nitric Oxide in the Upper Atmosphere2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    The forcing of the Sun on Earth's atmosphere manifests itself via solar radiation and energetic particle precipitation (EPP), which variations are most noticeable in the upper regions of the atmosphere. A key species in the lower thermosphere, which is influenced by solar forcing, is nitric oxide (NO). An NO reservoir is present in the lower thermosphere, from which NO-rich air can be transported downward into the mesosphere and stratosphere, where it takes part in catalytic ozone destruction cycles. For climate models to correctly simulate the solar forcing on our climate, the processes of NO production and destruction, as well as the descent into the lower atmosphere, must be understood and accurately represented.

    In this thesis, observations from the Solar Occultation For Ice Experiment (SOFIE) instrument onboard the Aeronomy of Ice in the Mesosphere (AIM) satellite are used to investigate temporal characteristics of NO in the mesosphere and lower thermosphere. We have developed a diagnostic method to determine the relative importance of the NO physical drivers throughout the lower thermosphere. The method shows that, at high latitudes, precipitating auroral electrons dominantly drive NO variations. Comparisons with NO measurements by the Student Nitric Oxide Experiment (SNOE), made almost a decade earlier, reveal that the impact of this forcing on NO appears to be invariant throughout the 11 year solar cycle.

    On shorter timescales, we have shown a clear signature of the reoccurring 27 day geomagnetic impact on NO concentrations during summer and winter, with subsequent descent into the lower mesosphere during winter. The occurrence of medium energy electrons, which precipitate to mesospheric altitudes, results in a further increase of the descending NO flux. This complicates the determination of the relative contribution of the EPP direct and indirect effect on NO, i.e. separating direct NO production from downwards transported NO, respectively, in NO enhancements at a certain altitude. Using a full-range energy spectrum from the Polar-orbiting Operational Environmental Satellites (POES), we have been able to disentangle the direct and indirect EPP effect on Southern hemispheric NO during a geomagnetic storm in 2010.

    Simulations of NO by the Whole Atmosphere Community Climate Model with Specified Dynamics (SD-WACCM) model reveal that the model predicts a too high climatological mean, while the short term variability is too low, as compared to SOFIE. However, even though the dynamical transport in both model and observations agrees very well, the descending NO fluxes are too low in the model.

    In conclusion, the results of this thesis provide a better understanding of NO variability from an observational standpoint and will enable better model representations in the future.

  • Disputas: 2018-03-09 13:00 sal G, Arrheniuslaboratorierna, Stockholm
    Svensson Källberg, Petra
    Stockholms universitet, Naturvetenskapliga fakulteten, Institutionen för matematikämnets och naturvetenskapsämnenas didaktik.
    Immigrant students' opportunities to learn mathematics: In(ex)clusion in mathematics education2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    This thesis explores immigrant students’ opportunities to learn mathematics. The research is concerned with issues of social justice and adopts a socio-political approach. Immigrant students are often described as students who do poorly in school because they lack “Swedishness” and have insufficient Swedish language skills. This deficit discourse is used when explaining immigrant students’ failure in mathematics, which this thesis aims to critique. Also, by adopting two theoretical frameworks, one that draws on the work of Skovsmose (1994, 2014) and one on the work of Foucault (2000, 2002), it aims at exploring possible understandings of immigrant students’ opportunities to learn mathematics.

    The research questions are addressed in a preamble and four articles. They address immigrant students’ perceptions of their opportunities to learn mathematics and how these perceptions come into existence, and the different contributions of using the theoretical frameworks.

    Data emanates from interviews, with immigrant students aged 15 to 16 years old and policy texts regarding schooling for newly arrived. Skovsmose’s notion of foreground is used when analysing immigrant students’ perceptions of their opportunities to learn mathematics. A Foucauldian perspective is used for exploring immigrant students’ identity formations as mathematical learners in a context of a forced school transition. The notions of fabrication and abjection (Popkewitz, 2012, 2013) are used as analytical tools when exploring how the newly arrived student as a mathematical learner is fabricated in policy texts.

    The findings show how conditions concerning future plans, otherness, Swedishness, perceiving their parents as deficit in relation to Swedish parents, segregation, feelings of exclusion and rowdy mathematics classrooms constitute their foregrounds, and affect their perceptions of their opportunities to learn mathematics. It was also shown how students’ identity formations as learners of mathematics are dynamic and enabled by discourse. For example, discourses operating in two different school contexts enabled the transitioning students to form identities as un-engaged and respectively engaged mathematics students. It was shown how students’ perceptions were influenced by public discourses, and thus how categorisations of them as immigrant students with deficiencies had looped into their lives. By exploring fabrication of the newly arrived student as a mathematical learner and the process of abjection information on how students may be ordered in relation to what degree they have come to master for example the Swedish language were provided. This may generate feelings of in(ex)clusion, which refers to the inseparability of inclusion and exclusion: any move to include brings with it potential exclusions.

    A conclusion is that to be able to understand immigrant students’ opportunities to learn mathematics and explain achievement in mathematics, deficiency explanations are not sufficient. Instead, it is of importance to try to understand the students’ perspectives and explore the role of discourse and power since it allows for explanations that ground students’ opportunities to learn mathematics in the socio-political conditions in which they emerge. This enables for learning more about what constitutes immigrant students’ perceptions and how they come into existence and thus allows for addressing processes of in(ex)clusion and critique deficiency explanations.

  • Disputas: 2018-03-09 13:00 JMK-salen, Garnisonen, Stockholm
    Dahlin, Emma
    Stockholms universitet, Humanistiska fakulteten, Institutionen för mediestudier.
    Ontological Ordering: Achieving Audience in Internet Practice2018Doktoravhandling, monografi (Annet vitenskapelig)
    Abstract [en]

    Against the backdrop of changing technological conditions of the contemporary media landscape, new questions arise regarding how audience can be can problematized and theorized. This dissertation seeks to shift the focus from conventional assumptions of what audience is to an empirical exploration of the specificities of the process through which audience is achieved in practice. This involves revisiting and questioning ontological assumptions about the nature of audience.

      The aim of the study is to develop an alternative approach for theorizing audience. A three year and seven months’ exploration of one example of an audience practice, the empirical focus is on the Gallifrey Base, an internet discussion forum for viewers of the TV series Doctor Who. To explore the specifics of audience as reality-in-practice, a methodological approach is developed that adjusts ethnographic research methods to align with a concern with ontology in audience practice – an audienceography. This dissertation thereby makes questions of ontology an empirical concern, drawing attention to how practices make up realities – that is, to how ontology is achieved. By turning to theoretical and methodological insights from Science and Technology Studies (STS), this study sets out to particularize how audience is achieved on the Gallifrey Base.

       Three chapters detail and analyze how practices on the Gallifrey Base achieve audience. Each build on the findings from the previous chapter, attending to ontological ordering in different ways, delving deeper into the details of the unfolding audience practice. The findings show how multiple ontologies can co-exist. In contrast to classic communication models, it is argued that the significance of communication by other means is about more than sending and receiving messages. An implication for the theorization of audience is that communication can have other purposes, as messages may be sent and received in order to maintain a particular communication practice.

      In relation to audience studies, the dissertation makes a theoretical contribution by connecting insights from recent debates on ontology and multiplicity in STS to empirical explorations of audience, thus widening the scope of the theoretical explanatory basis. The empirical contribution is to demonstrate that rather than a natural and stable structure, much work is invested in trying to maintain multiplicity even in the single audience practice of the Gallifrey Base forum. This suggests that ontologically fixed and given theoretical notions of audience are not compatible with contemporary audience practice. Audience practice, it is found, may include a range of multiple modes, which calls for attentiveness to the situated work carried out by various actors in the achievement of audience. In light of these findings, it is argued that approaching audience as ontology-in-practice provides a foundation for further theorizations of contemporary audience.

      Connecting the findings from Ontological Ordering to wider concerns in the humanities and social sciences – a concern with audience becomes a concern with the processes and implications of how we interact with media material and media devices, which in contemporary media environment is intensely technological. 

  • Disputas: 2018-03-09 10:00 Aula Svea, Socialhögskolan, Stockholm
    Pålsson, David
    Stockholms universitet, Samhällsvetenskapliga fakulteten, Institutionen för socialt arbete - Socialhögskolan.
    The Prerequisites and Practices of Auditing Residential Care: On the Licensing and Inspection of Residential Homes for Children in Sweden2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    The aim of this dissertation is to describe and analyse the prerequisites and practices of auditing Swedish residential care for children. Residential care is a complex intervention provided to children in vulnerable life situations. The care is extensively delivered by private providers and shows difficulties in demonstrating clearly positive treatment effects. Licensing and inspections are policy instruments to address alleged quality problems in decentralised and marketised welfare services. However, in research there are mixed opinions on the ability of audits to generate improved service quality.

    The dissertation consists of four papers exploring central facets of the audit system. The empirical material is based on interviews (n=50) with inspectors and residential staff, documentation (n=286) in terms of guidelines and license/inspection decisions and observations (n=12) at inspection-related events. Each paper includes a unique set of data.

    Paper I analyses the controls that private residential homes undergo prior to their entry into the market. The results show that a majority of applicants are granted a license and that the controls do not reduce the need for ex post control. There is limited guidance on care content and research evidence is weakly incorporated in the controls. Overall, the state exerts limited influence over the composition and professional development of the care market.

    Paper II explores the operationalisation process of care quality in inspections. The results show that the standards display a marked variation and there is no differentiation between different residential homes. In general, the standards focus on reducing malpractice and not maximising care quality. In practice, the inspections are often discussion-based and standards relating to work with children are often indistinct.

    Paper III analyses how inspections are perceived by representatives from residential homes. The results show that inspections induce reflection and to some extent shape the administrative parts of care, but also that it is difficult to discern the actual impact of the inspections on the work. The inspections appear to bring a degree of stability and legitimacy to the work, but there are sometimes tensions between standards and professional judgment.

    Paper IV studies the influence the inspection process grants children in care. The results suggest that different inspectorial rationales (regulative, supportive and protective) may influence the agency children exert and that it is difficult to allow children’s views to have a substantial impact on the process. Overall, there tends to be a gap between what the children find important and what the audits can address in concrete terms.

    The theoretical ideas used to analyse the results are derived from institutional organisational theory and the thesis on the audit society. The overall analysis shows that 1) making certain core care aspects auditable and ensuring their impact is difficult (e.g., children-staff relationships, children’s views and use of research knowledge), 2) the system has a restrained character and is in many senses associated with inconclusive formative effects, 3) the use of uniform goals does not necessarily equal a more suitable care provision and 4) the audits signify strong symbolic values. Despite the limitations, the audits may help to discipline care providers, secure a minimum level relative to the audited care aspects and induce reflection among auditees.

  • Kunst, Jonas R.
    et al.
    Univ Oslo, Dept Psychol, Oslo, Norway.;Univ Oslo, Ctr Res Extremism, Oslo, Norway.;Aarhus Univ, Dept Polit Sci, Aarhus, Denmark..
    Boos, Beverly
    Univ Oslo, Dept Psychol, Oslo, Norway..
    Kimel, Sasha Y.
    Harvard Univ, Dept Psychol, 33 Kirkland St, Cambridge, MA 02138 USA..
    Obaidi, Milan
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Samhällsvetenskapliga fakulteten, Institutionen för psykologi.
    Shani, Maor
    Jacobs Univ Bremen, Bremen, Germany..
    Thomsen, Lotte
    Univ Oslo, Dept Psychol, Oslo, Norway.;Aarhus Univ, Dept Polit Sci, Aarhus, Denmark..
    Engaging in extreme activism in support of others' political struggles: The role of politically motivated fusion with out-groups2018Inngår i: PLoS ONE, ISSN 1932-6203, E-ISSN 1932-6203, Vol. 13, nr 1, artikkel-id e0190639Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Humans are a coalitional, parochial species. Yet, extreme actions of solidarity are sometimes taken for distant or unrelated groups. What motivates people to become solidary with groups to which they do not belong originally? Here, we demonstrate that such distant solidarity can occur when the perceived treatment of an out-group clashes with one's political beliefs (e.g., for Leftists, oppressive occupation of the out-group) and that it is driven by fusion (or a feeling of oneness) with distant others with whom one does not share any common social category such as nationality, ethnicity or religion. In Study 1, being politically Leftist predicted European-Americans' willingness to engage in extreme protest on behalf of Palestinians, which was mediated by fusion with the out-group. Next, in Study 2, we examined whether this pattern was moderated by out-group type. Here, Norwegian Leftists fused more with Palestinians (i.e., a group that, in the Norwegian context, is perceived to be occupied in an asymmetrical conflict) rather than Kurds (i.e., a group for which this perception is less salient). In Study 3, we experimentally tested the underlying mechanism by framing the Kurdish conflict in terms of an asymmetrical occupation (vs. symmetrical war or control conditions) and found that this increased Leftist European-Americans' fusion with Kurds. Finally, in Study 4, we used a unique sample of non-Kurdish aspiring foreign fighters who were in the process of joining the Kurdish militia YPG. Here, fusion with the out-group predicted a greater likelihood to join and support the Kurdish forces in their fight against ISIS, insofar as respondents experienced that their political orientation morally compelled them to do so (Study 4). Together, our findings suggest that politically motivated fusion with out-groups underpins the extreme solidary action people may take on behalf of distant out-groups. Implications for future theory and research are discussed.

  • Hughes, Ryan E.
    et al.
    Weiberg, Erika
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Historisk-filosofiska fakulteten, Institutionen för arkeologi och antik historia, Antikens kultur och samhällsliv.
    Bonnier, Anton
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Historisk-filosofiska fakulteten, Institutionen för arkeologi och antik historia, Antikens kultur och samhällsliv.
    Finné, Martin
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Historisk-filosofiska fakulteten, Institutionen för arkeologi och antik historia, Antikens kultur och samhällsliv.
    Kaplan, Jed O.
    Quantifying Land Use in Past Societies from Cultural Practice and Archaeological Data2018Inngår i: Land, ISSN ISSN 2073-445X, Vol. 7, nr 1, artikkel-id 9Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Quantitative reconstructions of past land use facilitate comparisons between livelihoods in space and time. However, comparison between different types of land use strategies is challenging as land use has a multitude of expressions and intensities. The quantitative method presented here facilitates the exploration and synthetization of uneven archaeological and textual evidence from past societies. The approach quantifies the area required for habitation, agriculture, arboriculture, pasturage, and fuel supply, based on a combination of archaeological, historical, ethnographic and modern evidence from the relevant geographical region. It is designed to stimulate discussion and can be used to test a wide range of hypotheses regarding local and regional economies, ancient trade and redistribution, and the resilience and/or vulnerability of past societies to environmental change. The method also helps identify where our gaps in knowledge are in understanding past human–environment interaction, the ecological footprint of past cultures and their influence on the landscape in a transparent and quantitative manner. The present article focuses especially on the impact of dietary estimates and crop yield estimates, two main elements in calculating land use in past societies due to their uncertainty as well as their significant impact on calculations. By employing archaeological data, including botanical, zoological and isotopic evidence, alongside available textual sources, this method seeks to improve land use and land cover change models by increasing their representativeness and accuracy.

  • Polanska, Dominika V.
    Uppsala universitet, Humanistisk-samhällsvetenskapliga vetenskapsområdet, Samhällsvetenskapliga fakulteten, Institutet för bostads- och urbanforskning (IBF).
    Going against institutionalization: New forms of urban activism in Poland2018Inngår i: Journal of Urban Affairs, ISSN 0735-2166, E-ISSN 1467-9906Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The first decade after the fall of state socialism in Poland was characterized by moderate aspirations to reform or oppose the dominant (neoliberal) rhetoric by social movements in the country. In the last decade, a turn toward more informal grassroots activity has been observed by scholars, above all in the field of urban activism. This article looks into this recent development in urban activism and focuses especially on the hitherto neglected grassroots, noninstitutionalized, and nonformalized forms of activism that take place in Polish cities aimed at urban change. It will be argued that this form of urban activism developed as a reaction to professionalization and NGO-ization of social movements, defying the (until now) established forms of organizing collectively. The analysis is built on qualitative data gathered in 2014–2015, including 36 in-depth interviews with urban activists in informal initiatives and groups in different Polish cities.

  • Bergman, Patrick
    Linnéuniversitetet, Fakulteten för samhällsvetenskap (FSV), Institutionen för idrottsvetenskap (ID).
    The number of repeated observations needed to estimate the habitual physical activity of an individual to a given level of precision.2018Inngår i: PLoS ONE, ISSN 1932-6203, E-ISSN 1932-6203, Vol. 13, nr 2, artikkel-id e0192117Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Physical activity behavior varies naturally from day to day, from week to week and even across seasons. In order to assess the habitual level of physical activity of a person, the person must be monitored for long enough so that the level can be identified, taking into account this natural within-person variation. An important question, and one whose answer has implications for study- and survey design, epidemiological research and population surveillance, is, for how long does an individual need to be monitored before such a habitual level or pattern can be identified to a desired level of precision? The aim of this study was to estimate the number of repeated observations needed to identify the habitual physical activity behaviour of an individual to a given degree of precision. A convenience sample of 50 Swedish adults wore accelerometers during four consecutive weeks. The number of days needed to come within 5-50% of an individual's usual physical activity 95% of the time was calculated. To get an idea of the uncertainty of the estimates all statistical estimates were bootstrapped 2000 times. The mean number of days of measurement needed for the observation to, with 95% confidence, be within 20% of the habitual physical activity of an individual is highest for vigorous physical activity, for which 182 days are needed. For sedentary behaviour the equivalent number of days is 2.4. To capture 80% of the sample to within ±20% of their habitual level of physical activity, 3.4 days is needed if sedentary behavior is the outcome of interest, and 34.8 days for MVPA. The present study shows that for analyses requiring accurate data at the individual level a longer measurement collection period than the traditional 7-day protocol should be used. In addition, the amount of MVPA was negatively associated with the number of days required to identify the habitual physical activity level indicating that the least active are also those whose habitual physical activity level is the most difficult to identify. These results could have important implications for researchers whose aim is to analyse data on an individual level. Before recommendations regarding an appropriate monitoring protocol are updated, the present study should be replicated in different populations.

  • Nordin, Fredrik
    Stockholms universitet, Samhällsvetenskapliga fakulteten, Företagsekonomiska institutionen, Marknadsföring.
    Möller, Kristian ()
    Mohr, Jakki ()
    Network management in emergent high-tech business contexts: Critical capabilities and activities2017Inngår i: Industrial Marketing Management, ISSN 0019-8501, E-ISSN 1873-2062Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Due to their inherent uncertainty, emerging high-tech business fields require a unique set of network management capabilities. Drawing from the dynamic capabilities literature and the networking capability literature, we develop a framework for network management in such environments. The framework consists of three interrelated capabilities – context handling, network construction, and network position consolidation. A longitudinal case study of a start-up company in the smart energy sector validates and provides an illustrative understanding of the three capabilities. The findings identify how they are enacted through a portfolio of activities, providing a microfoundational insight into how a focal actor in an entrepreneurial and explorative manner navigates and manages a business field in the making. Our research contributes a novel conceptualization of network management capabilities with an explicit focus on attracting, establishing and managing relationships in the complex and uncertain environment of emerging high-tech fields. In addition, our research offers guidance to managers with respect to the capabilities they need to galvanize and coalesce actors in an emerging business network.

  • Kohlbacher, Anton
    et al.
    Luleå tekniska universitet.
    Eliasson, Jens
    Luleå tekniska universitet, Institutionen för system- och rymdteknik, EISLAB.
    Acres, Kevin
    Monash Swarm Robotics Laboratory, Monash University.
    Chung, Hoam
    Monash Swarm Robotics Laboratory, Monash University.
    Barca, Jan Carlo
    Monash Swarm Robotics Laboratory, Monash University.
    A Low Cost Omnidirectional Relative Localization Sensor for Swarm Applications2018Inngår i: IEEE 4th World Forum on Internet of Things, 2018Konferansepaper (Fagfellevurdert)
    Abstract [en]

    By enabling coordinated task execution and movement, robotic swarms can achieve efficient exploration of unknown environments. In this paper, we propose a relative localization sensor system using Ultra-wideband (UWB) radio technology for ranging. This system is light-weight and relatively indifferent to the types of surrounding environments. Infrastructure dependency such as the requirement of beacons at known locations is eliminated by making an array of sensors on a swarm agent. In this paper, a novel algorithm is implemented on hardware with limited resources and compared to a more traditional trilateration approach. Both utilize Particle Swarm Optimization (PSO) to be more robust against noise and to achieve similar accuracy. The experimental results show that the proposed algorithm runs up to ten times faster than the existing trilateration approach. The sensor array which forms the localization system weighs only 56g, and achieves around 0.5m RMSE with a 10Hz update rate. Experiments show that the accuracy can be further improved if the rotational bias observed in the UWB devices are compensated for.

  • Birk, Wolfgang
    et al.
    Luleå tekniska universitet, Institutionen för system- och rymdteknik, Signaler och system.
    Castaño Arranz, Miguel
    Luleå tekniska universitet, Institutionen för system- och rymdteknik, Signaler och system.
    Moaveni, Bijan
    Control and Signaling Department, Iran University of Science and Technology.
    Perspectives and Future Directions in Control Configuration Selection (PiCCS): Workshop Notes2017Rapport (Annet vitenskapelig)
    Abstract [en]

    The PiCCS workshop took place at Luleå University of Technology on 16th and 17th of August 2017. In total 20 researcher and engineers from industry participated in the event.

    The main aim of the workshop was to bring together expert in the field of Control Configuration Selection (CCS), which is a sub-field in the research area Automatic Control, to discuss the current state of the art and identify remaining challenges in the field. The identified challenges were formulated as future directions and are summarized in this report, together with an account of the discussion during these two days.

    The workshop explored the following topics Implementing optimal operation using simple control elements, Real time optimisation approach in control structure design and benchmarking, Data driven control configuration selection, and Reconfiguration of control structures. Based on the outcome of the discussion, a group of participants proposed an invited session for the 2018 IFAC AdChem Symposium, which has been accepted at the time of the publication of this report and consists of 6 papers addressing challenges discussed during the workshop.

  • Svensson, Carita
    et al.
    Edfors, Ellinor
    Högskolan Kristianstad, Forskningsmiljön PRO-CARE, Patient Reported Outcomes - Clinical Assessment Research and Education. Högskolan Kristianstad, Fakulteten för hälsovetenskap, Avdelningen för sjuksköterskeutbildningarna och integrerad hälsovetenskap. Högskolan Kristianstad, Forskningsplattformen för Hälsa i samverkan.
    Edberg, Anna-Karin
    Högskolan Kristianstad, Forskningsplattformen för Hälsa i samverkan. Högskolan Kristianstad, Fakulteten för hälsovetenskap, Avdelningen för sjuksköterskeutbildningarna och integrerad hälsovetenskap.
    Sjuksköterskors upplevelser av faktorer som bidrar till närvaro i mötet med äldre personer2017Rapport (Annet vitenskapelig)
    Abstract [sv]

    Hur upplever sjuksköterskan mötet med den äldre personen inom kommunal vård ochomsorg? Ett sätt för sjuksköterskan att känna närvaro i mötet är genom att helhjärtatlyssna på den äldre när hen inbjuder till samtal om sina tankar eller om livshistorian.Sjuksköterskan kan genom mötet uppleva en högre mening med sitt arbete och få enmöjlighet att etablera en relation med den äldre. Att vårda äldre personer ställer högakrav på omvårdnaden där en helhetssyn med fokus på personcentrerad omvårdnadstår i centrum och kunskaper i äldre personers psykologiska och sociala åldrande kanhjälpa sjuksköterskan vara närvarande i mötet. Syftet var att beskriva sjuksköterskorsupplevelser av faktorer som bidrar till möjligheten att vara närvarande i mötet medäldre personer inom kommunal vård och omsorg. Nio intervjuer genomfördes medsjuksköterskor inom kommunal vård och omsorg. Intervjuerna analyserades med hjälpav kvalitativ innehållsanalys. Resultatet visade att sjuksköterskorna hade som sin främstaintention att prioritera mötet med vårdtagaren. Faktorer som bidrog till sjuksköterskornasmöjlighet till närvaro i mötet med äldre var relaterade till; (I) mötet i form avatt kunna bygga på en tidigare relation, att ha gemensamma beröringspunkter, att haen ömsesidig öppenhet och vilja att dela varandras glädje- och sorgeämnen (II) vårdtagareni form av att vårdtagaren har förtroende för sjuksköterskan, att vårdtagareninbjuder till samtal och vårdtagarens tillstånd (III) sjuksköterskan i form av kunskaperom vårdtagaren och betydelsen av att vara närvarande i mötet, personlig mognad ochsjälvkännedom, att vara genuint intresserad av vårdtagaren och visa respekt och attkunna hantera sina känslor, samt (IV) organisationen i form av att ha tid, att ha möjlighetatt prioritera mellan olika arbetsuppgifter, hur vårdarbetet fördelas och organiserasoch den kontext som sjuksköterskan befinner sig i. Resultatet visade att sjuksköterskornahade som intention att vara närvarande i mötet. Det var dock inte alltid så lättatt få tid till mötet på grund av tids- och/eller personalbrist, men även sjuksköterskanspersonliga mognad och erfarenhet hade betydelse för att kunna/våga vara närvarandei mötet. En positiv och stödjande arbetsledning samt ett nära samarbete med kollegersågs som viktiga resurser i det dagliga omvårdnadsarbetet.

  • Sayadi, Ahmed
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Zooekologi.
    Immonen, Elina
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Zooekologi.
    Tellgren-Roth, Christian
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för immunologi, genetik och patologi. Uppsala universitet, Science for Life Laboratory, SciLifeLab.
    Arnqvist, Göran
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Biologiska sektionen, Institutionen för ekologi och genetik, Zooekologi.
    The Evolution of Dark Matter in the Mitogenome of Seed Beetles2017Inngår i: Genome Biology and Evolution, ISSN 1759-6653, E-ISSN 1759-6653, Vol. 9, nr 10, s. 2697-2706Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Animal mitogenomes are generally thought of as being economic and optimized for rapid replication and transcription. We use long-read sequencing technology to assemble the remarkable mitogenomes of four species of seed beetles. These are the largest circular mitogenomes ever assembled in insects, ranging from 24,496 to 26,613 bp in total length, and are exceptional in that some 40% consists of non-coding DNA. The size expansion is due to two very long intergenic spacers (LIGSs), rich in tandem repeats. The two LIGSs are present in all species but vary greatly in length (114-10,408 bp), show very low sequence similarity, divergent tandem repeat motifs, a very high AT content and concerted length evolution. The LIGSs have been retained for at least some 45 my but must have undergone repeated reductions and expansions, despite strong purifying selection on protein coding mtDNA genes. The LIGSs are located in two intergenic sites where a few recent studies of insects have also reported shorter LIGSs (>200 bp). These sites may represent spaces that tolerate neutral repeat array expansions or, alternatively, the LIGSs may function to allow a more economic translational machinery. Mitochondrial respiration in adult seed beetles is based almost exclusively on fatty acids, which reduces the need for building complex I of the oxidative phosphorylation pathway (NADH dehydrogenase). One possibility is thus that the LIGSs may allow depressed transcription of NAD genes. RNA sequencing showed that LIGSs are partly transcribed and transcriptional profiling suggested that all seven mtDNA NAD genes indeed show low levels of transcription and co-regulation of transcription across sexes and tissues.

  • Wettervik, Teodor Svedung
    et al.
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Lenell, Samuel
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Nyholm, Lena
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Howells, Tim
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Lewén, Anders
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Enblad, Per
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för neurovetenskap, Neurokirurgi.
    Decompressive craniectomy in traumatic brain injury: usage and clinical outcome in a single centre2018Inngår i: Acta Neurochirurgica, ISSN 0001-6268, E-ISSN 0942-0940, Vol. 160, nr 2, s. 229-237Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Background: Two randomised controlled trials (RCTs) of decompressive craniectomy (DC) in traumatic brain injury (TBI) have shown poor outcome, but there are considerations of how these protocols relate to real practice. The aims of this study were to evaluate usage and outcome of DC and thiopental in a single centre.

    Method: The study included all TBI patients treated at the neurointensive care unit, Akademiska sjukhuset, Uppsala, Sweden, between 2008 and 2014. Of 609 patients aged 16 years or older, 35 treated with DC and 23 treated with thiopental only were studied in particular. Background variables, intracranial pressure (ICP) measures and global outcome were analysed.

    Results: Of 35 DC patients, 9 were treated stepwise with thiopental before DC, 9 were treated stepwise with no thiopental before DC and 17 were treated primarily with DC. Six patients received thiopental after DC. For 23 patients, no DC was needed after thiopental. Eighty-eight percent of our DC patients would have qualified for the DECRA study and 38% for the Rescue-ICP trial. Favourable outcome was 44% in patients treated with thiopental before DC, 56% in patients treated with DC without prior thiopental, 29% in patients treated primarily with DC and 52% in patients treated with thiopental with no DC.

    Conclusions: The place for DC in TBI management must be evaluated better, and we believe it is important that future RCTs should have clearer and less permissive ICP criteria regarding when thiopental should be followed by DC and DC followed by thiopental.

  • Disputas: 2018-03-08 13:00 Rosen, Uppsala
    Santos, Arnoldo
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för kirurgiska vetenskaper, Hedenstiernalaboratoriet.
    Hemodynamic Effects of Lung Function Optimization in Experimental Acute Respiratory Distress Syndrome2018Doktoravhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    Acute Respiratory Distress Syndrome (ARDS) is a severe pulmonary inflammation affecting thousands of patients every year in Sweden and has a mortality of 30-50%. Mechanical ventilation (MV) is usually necessary, but could per se augment the inflammation and contribute to mortality. MV strategies protective for the lung parenchyma have been developed but without considering the pulmonary circulation or the right heart ventricle (RV) that also are affected in ARDS. MV should ideally be optimized to protect both the lung parenchyma and the RV/pulmonary vasculature. My hypothesis was that MV that prevents alveolar collapse and overdistension, i.e., the “open lung approach (OLA)” would be optimal. The aims of this project were 1) to carefully describe the pulmonary vascular mechanics (PVM) in ARDS compared with healthy lungs, 2) to assess how different ventilatory methods influence PVM, and 3) to propose a ventilatory method that protects both lung parenchyma and circulation.

    In a porcine model, high fidelity pressure and flow sensors were applied directly on the main pulmonary artery to evaluate steady and oscillatory components of PVM.  In this way a complete PVM description was obtained for normal and injured lungs at different MV. In particular, the effects of OLA were compared with standard MV and, in addition, with MV methods where overdistension or collapse were present.

    Results: 1) Compared with collapse or overdistension, OLA provided better PVM. 2) The effects on PVM of OLA and the standard protective MV were similar. 3) Early ARDS augmented the effects of pulse wave reflection on PVM leading to a situation in which the RV had to increase its work to maintain adequate blood flow. Thus, a part of this work was wasted by the effect of wave reflections, making the RV/pulmonary vasculature inefficient. 4) Tidal breathing affected PVM cyclically and this effect was enhanced in ARDS compared with healthy lungs.

    In conclusion, ARDS and different ventilatory methods, as well as tidal ventilation per se, affected PVM. OLA improved PVM compared with other MV settings where significant collapse and overdistension were allowed. However, OLA was not superior to standard protective MV.

  • Morata, Berta
    Luleå tekniska universitet, Institutionen för samhällsbyggnad och naturresurser, Arkitektur och vatten.
    The Northbothnian Technological Megasystem: Urbanization, territorial metabolism and political ecologies2018Inngår i: Urbanism & Urbanization: On Reproduction: Re-Imagining the Political Ecology of Urbanism / [ed] Michiel Dehaene, David Peleman, Ghent University, 2018, s. 87-102, artikkel-id -Konferansepaper (Fagfellevurdert)
    Abstract [en]

    Planetary Urbanization (Brenner, Shmid, 2011) opens up a radical shift in analysis from urban form to urbanization process, as suggested through the radical hypothesis of the complete urbanization of society, put forward by Henri Lefebvre four decades ago. This situation means, that even spaces that lie well beyond the traditional city cores and suburban peripheries, have become integral parts of the worldwide urban fabric. Political-economic spaces can no longer be treated as if they were composed of discrete, distinct, and universal “types” of settlement.

    Under such scope, in every region of the globe, erstwhile “wilderness” spaces are being transformed and degraded through the cumulative socio-ecological consequences of unfettered worldwide urbanization. In this way, the world’s oceans, alpine regions, the equatorial rainforests, major deserts, the arctic and polar zones, and even the earth’s atmosphere itself, are increasingly interconnected with the rhythms of planetary urbanization at every geographical scale, from the local to the global. These spaces become critical for urban development (and moreover, for urban political ecology debate). For that, Sweden is a paradigmatic case study where the urbanization of the southern part of the country is sustained upon an extremely intensive appropriation of natural resources from the North (Sörling 1988), (Tidholm 2014).

    Norrboten, the northernmost land of Sweden, is a paradigm for territorial metabolism where a complex combination system of mining industry urbanization shaped the area. Thus becoming the connecting concept of Norrbotten Technological Megasystem NTM (Hansson,  1990) [fig.1], it’s key actors: natural resources, mining, transport, H2O, energy, military infrastructure, mining communities, the indigenous Sami. Today the nature of industry remains the same, the social, political and economic leverage NTM exerts over the region is absolute; the economic profit, financial stability and wealth of the Swedish state take precedence over the environment. However, much of the industrial paradigm that underpinned its implementation is now under a severe change; as the global economy is facing an era of human development where resources, metals, minerals and energy will be more critical than ever, a renewed urban and territorial framework is urgently needed. The set of relations between environment and communities is currently under an unprecedented revision based on socio-environmental reflections.

    This short paper will pose for discussion how heavy territorial infrastructure respond to the changing metabolism that is following after the short-term appropriation of resources so characteristic of industrial development in northern Europe. By critical graphic comparative analysis and trans-scalar research by design (Barcelloni & Cavalieri, 2015), the thesis will empirically investigate these processes to be able to cope with the debate on infrastructural adaptation through political ecology perspective.

  • Sundström, David
    et al.
    Mittuniversitetet, Fakulteten för naturvetenskap, teknik och medier, Avdelningen för kvalitetsteknik, maskinteknik och matematik.
    Carlsson, Peter
    Mittuniversitetet, Fakulteten för naturvetenskap, teknik och medier, Avdelningen för kvalitetsteknik, maskinteknik och matematik.
    Andersson, Erik
    Mittuniversitetet, Fakulteten för humanvetenskap, Avdelningen för hälsovetenskap.
    Comparison of Power Output Estimates in Treadmill Roller-Skiing2018Inngår i: Proceedings / [ed] Hugo G. Espinosa, David R. Rowlands, Jonathan Shepherd and David V. Thiel, Basel: MDPI AG , 2018, Vol. 2, artikkel-id 312Konferansepaper (Fagfellevurdert)
    Abstract [en]

    The purpose of this study was to evaluate and compare various power output estimates and estimate anaerobic energy supply during treadmill roller-skiing. Roller-skiing sprint time-trial performance on a treadmill was compared to numerical simulations of three different power output estimates; non-inertial power estimate (NIP), inertial power estimate (IP), and optimization power estimate (OP). The OP was in best agreement with the measured speed of the skier. However, the IP was in better agreement with the measured finishing time of the real time trial, which may suggest that the IP better approximated the mean power than the other two estimates. Moreover, the NIP and IP are more simplistic than the OP and thereby more practical from a scientific standpoint. Based on this we recommend the use of the IP estimate.

  • Disputas: 2018-03-15 10:00 Room 643 (Albert Danielsson), Stockholm
    Jazairy, Amer
    KTH, Skolan för industriell teknik och management (ITM), Industriell ekonomi och organisation (Inst.). University of Gävle, Sweden.
    Exploring shippers, logistics service providers and their relationships in facilitating green logistics2018Licentiatavhandling, med artikler (Annet vitenskapelig)
    Abstract [en]

    The logistics industry causes various harms to the environment. The literature assigns the main responsibility for alleviating such harms to two supply chain actors: shippers (logistics buyers) and logistics service providers (LSPs), which motivated studying them in this thesis. Specifically, this thesis explores and identifies how green logistics practices can be facilitated through aligning both actors throughout the different phases of their relationships. Two studies are compiled. The first study is based on five distinct cases -- three shippers and five LSPs, providing the basis for two papers: (i) one that analyses the institutional pressures (regulatory, market, competitive) on shippers to purchase green logistics services, and on LSPs to provide these services, and (ii) one that investigates the two actors’ stances on environmental concerns in the four key logistics purchasing phases (request for proposal, negotiations, contracting, execution), while proposing ways to align their efforts along such phases. The second study covers a single case of a dyadic relationship between a shipper and its LSP, handling enhancing logistics performance (cost efficiency, on-time delivery) in the early stages of their relationship. The findings indicate a general lack of regulatory pressure in driving shippers and LSPs to engage in green logistics, contrasted by a long-term influence of competitive pressure and a prevalent influence of market pressure. It was also found that both actors must put substantial efforts in the beginning of their relationships to reach a mutual business understanding, allowing performance and green enhancements. In the execution, it was found that both partners should regularly communicate performance metrics while modifying working standards, which would also support their green practices. For practitioners, insights are offered to align shippers’ and LSPs’ efforts within their relationships to attain positive performance and green outcomes.